PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G02590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 255aa    MW: 26947.6 Da    PI: 9.0308
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G02590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81e-1992146256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++k+q  +Lee+F+ +++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  OGLUM06G02590.1  92 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALAKSLNLRPRQVEVWFQNRRARTK 146
                      788899***********************************************98 PP

2HD-ZIP_I/II125.22.9e-4092182192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+++n+rL+ke +eLr +lk
  OGLUM06G02590.1  92 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALAKSLNLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRWCDQLADDNRRLHKELAELR-ALK 182
                      69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-1866149IPR009057Homeodomain-like
SuperFamilySSF466895.13E-1975149IPR009057Homeodomain-like
PROSITE profilePS5007116.66588148IPR001356Homeobox domain
SMARTSM003892.8E-1790152IPR001356Homeobox domain
CDDcd000865.10E-1692149No hitNo description
PfamPF000466.8E-1792146IPR001356Homeobox domain
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PfamPF021835.0E-11148182IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.3E-19148191IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MERQGLDLGL SLGLGLTTAA TWPAAGFCLN SGMAEQEVIR RDDVVAAAAA EDERFACSPG  60
SPVSSGSGKR GSGSGSGDEV DDAGCDVGGG ARKKLRLSKD QAAVLEECFK THHTLTPKQK  120
VALAKSLNLR PRQVEVWFQN RRARTKLKQT EVDCEHLKRW CDQLADDNRR LHKELAELRA  180
LKATPTPPAA APPLTTLTMC LSCKRVANAG VPSPAAAMFP GHPQFLCGFR DHAGAASSSY  240
GGASSGLAKA VRAAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8308960.0CT830896.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN014L20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642539.11e-130PREDICTED: homeobox-leucine zipper protein HOX28
SwissprotA2Y9311e-132HOX28_ORYSI; Homeobox-leucine zipper protein HOX28
SwissprotQ5VPE51e-132HOX28_ORYSJ; Homeobox-leucine zipper protein HOX28
TrEMBLA0A0E0A4S40.0A0A0E0A4S4_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g04850.11e-129(Oryza sativa Japonica Group)
STRINGBGIOSGA022270-PA1e-129(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-45homeobox from Arabidopsis thaliana